General Information

    • DRAMP ID

    • DRAMP04495

    • Peptide Name

    • Preprodefensin

    • Source

    • Ixodes ricinus (Common tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICVMK

    • Sequence Length

    • 39

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04495 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C199H300N58O48S7

    • Absent Amino Acids

    • ENW

    • Common Amino Acids

    • CG

    • Mass

    • 4497.35

    • PI

    • 9.42

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +9

    • Boman Index

    • -59.2

    • Hydrophobicity

    • -0.344

    • Aliphatic Index

    • 30

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 127.5

    • Polar Residues

    • 17

DRAMP04495

DRAMP04495 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Differential expression of Ixodes ricinus tick genes induced by blood feeding or Borrelia burgdorferi infection.

    • Reference

    • J Med Entomol. 2005 Jan;42(1):36-41.

    • Author

    • Rudenko N, Golovchenko M, Edwards MJ, Grubhoffer L.