• DRAMP ID

    • DRAMP04495
    • Peptide Name

    • Preprodefensin
    • Source

    • Ixodes ricinus (Common tick)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICVMK
    • Sequence Length

    • 39
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04495 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04495.
    • Formula

    • C199H300N58O48S7
    • Absent Amino Acids

    • ENW
    • Common Amino Acids

    • CG
    • Mass

    • 4497.35
    • PI

    • 9.42
    • Basic Residues

    • 10
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +9
    • Boman Index

    • -59.2
    • Hydrophobicity

    • -0.344
    • Aliphatic Index

    • 30
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 4845
    • Absorbance 280nm

    • 127.5
    • Polar Residues

    • 17

DRAMP04495

DRAMP04495 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Differential expression of Ixodes ricinus tick genes induced by blood feeding or Borrelia burgdorferi infection.
    • Reference

    • J Med Entomol. 2005 Jan;42(1):36-41.
    • Author

    • Rudenko N, Golovchenko M, Edwards MJ, Grubhoffer L.