General Information

    • DRAMP ID

    • DRAMP04497

    • Peptide Name

    • Gasa4-like protein (Predicted)

    • Source

    • Pelargonium zonale

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GSLKSSQCNPECTRRCSKTQYHKPCMFFCQKCCRKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP

    • Sequence Length

    • 66

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04497 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04497.

Physicochemical Information

    • Formula

    • C318H495N95O88S13

    • Absent Amino Acids

    • DI

    • Common Amino Acids

    • C

    • Mass

    • 7473.79

    • PI

    • 9.22

    • Basic Residues

    • 12

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +11

    • Boman Index

    • -123.21

    • Hydrophobicity

    • -0.729

    • Aliphatic Index

    • 22.12

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10720

    • Absorbance 280nm

    • 164.92

    • Polar Residues

    • 31

DRAMP04497

DRAMP04497 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A homolog of gip-1 (gibberellic acid-induced gene).

    • Reference

    • Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases

    • Author

    • Rosenwasser S, Granot D, Friedman H.