General Information

    • DRAMP ID

    • DRAMP04500

    • Peptide Name

    • GEG protein

    • Source

    • Gerbera hybrida (Daisy)

    • Family

    • Not found

    • Gene

    • geg

    • Sequence

    • IAASKINCGAACKARCRLSSRPNLCHRACGTCCARCRCVPPGTSGNQKVCPCYYNMTTHGGRRKCP

    • Sequence Length

    • 66

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04500 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04500.

Physicochemical Information

    • Formula

    • C284H477N103O82S13

    • Absent Amino Acids

    • DEFW

    • Common Amino Acids

    • C

    • Mass

    • 7063.33

    • PI

    • 9.56

    • Basic Residues

    • 14

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +14

    • Boman Index

    • -143.36

    • Hydrophobicity

    • -0.379

    • Aliphatic Index

    • 43.03

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3730

    • Absorbance 280nm

    • 57.38

    • Polar Residues

    • 32

DRAMP04500

DRAMP04500 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • GEG participates in the regulation of cell and organ shape during corolla and carpel development in gerbera hybrida.

    • Reference

    • Plant Cell. 1999 Jun;11(6):1093-1104.

    • Author

    • Kotilainen M, Helariutta Y, Mehto M, Pollanen E, Albert VA, Elomaa P, Teeri TH.