General Information

    • DRAMP ID

    • DRAMP04525

    • Peptide Name

    • Caenopore-5

    • Source

    • Not found

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RSALSCQMCELVVKKYEGSADKDANVIKKDFDAECKKLFHTIPFGTRECDHYVNSKVDPIIHELEGGTAPKDVCTKLNECP

    • Sequence Length

    • 81

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • The overall structure of the two caenopore-5 conformers consists of five amphiphatic helices connected by three disulfide bonds. The five helices are arranged in a folded leaf which is the characteristic signature of the SAPLIP family.

    • Helical Wheel Diagram

    • DRAMP04525 helical wheel diagram

    • Predicted Structure

Physicochemical Information

    • Formula

    • C393H627N107O124S7

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • K

    • Mass

    • 9059.36

    • PI

    • 5.88

    • Basic Residues

    • 15

    • Acidic Residues

    • 14

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +1

    • Boman Index

    • -157.35

    • Hydrophobicity

    • -0.503

    • Aliphatic Index

    • 70.99

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 41.94

    • Polar Residues

    • 23

DRAMP04525

DRAMP04525 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Caenopore-5: The three-dimensional structure of an antimicrobial protein from Caenorhabditis elegans.

    • Reference

    • Dev Comp Immunol. 2010 Mar;34(3):323-330.

    • Author

    • Mysliwy J, Dingley AJ, Stanisak M, Jung S, Lorenzen I, Roeder T, Leippe M, Grötzinger J.