• DRAMP ID

    • DRAMP04525
    • Peptide Name

    • Caenopore-5
    • Source

    • Not found
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • RSALSCQMCELVVKKYEGSADKDANVIKKDFDAECKKLFHTIPFGTRECDHYVNSKVDPIIHELEGGTAPKDVCTKLNECP
    • Sequence Length

    • 81
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • The overall structure of the two caenopore-5 conformers consists of five amphiphatic helices connected by three disulfide bonds. The five helices are arranged in a folded leaf which is the characteristic signature of the SAPLIP family.
    • Helical Wheel Diagram

    • DRAMP04525 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP04525.
    • Formula

    • C393H627N107O124S7
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • K
    • Mass

    • 9059.36
    • PI

    • 5.88
    • Basic Residues

    • 15
    • Acidic Residues

    • 14
    • Hydrophobic Residues

    • 23
    • Net Charge

    • +1
    • Boman Index

    • -157.35
    • Hydrophobicity

    • -0.503
    • Aliphatic Index

    • 70.99
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 41.94
    • Polar Residues

    • 23

DRAMP04525

DRAMP04525 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Caenopore-5: The three-dimensional structure of an antimicrobial protein from Caenorhabditis elegans.
    • Reference

    • Dev Comp Immunol. 2010 Mar;34(3):323-330.
    • Author

    • Mysliwy J, Dingley AJ, Stanisak M, Jung S, Lorenzen I, Roeder T, Leippe M, Grötzinger J.