General Information

    • DRAMP ID

    • DRAMP04526

    • Peptide Name

    • Parigidin-br1 (Cyclotides; Plants)

    • Source

    • Palicourea rigida (Rubiaceae)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SCVFIPCITSLAGCSCKNKVCYYDGGSVPCGE

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04526 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04526.

Physicochemical Information

    • Formula

    • C140H219N35O45S6

    • Absent Amino Acids

    • HMQRW

    • Common Amino Acids

    • C

    • Mass

    • 3304.85

    • PI

    • 5.78

    • Basic Residues

    • 2

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • 0

    • Boman Index

    • -6.61

    • Hydrophobicity

    • 0.481

    • Aliphatic Index

    • 66.88

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 108.23

    • Polar Residues

    • 18

DRAMP04526

DRAMP04526 chydropathy plot

Comments Information

    • Function

    • Parigidin-br1 showes potent insecticidal activity against neonate larvae of Lepidoptera (Diatraea saccharalis), causing 60% mortality at a concentration of 1 µm but had no detectable antibacterial effects.

Literature Information

  • ·Literature 1

    • Title

    • Identification and structural characterization of novel cyclotide with activity against an insect pest of sugar cane.

    • Reference

    • J Biol Chem. 2012 Jan 2;287(1):134-147.

    • Author

    • Pinto MF, Fensterseifer IC, Migliolo L, Sousa DA, de Capdville G, Arboleda-Valencia JW, Colgrave ML, Craik DJ, Magalhães BS, Dias SC, Franco OL.