General Information

    • DRAMP ID

    • DRAMP04527

    • Peptide Name

    • Luxuriosin

    • Source

    • Acalolepta luxuriosa (longicorn beetle)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SVRTQDNAVNRQIFGSNGPYRDFQLSDCYLPLETNPYCNEWQFAYHWNNALMDCERAIYHGCNRTRNNFITLTACKNQAGPICNRRRH

    • Sequence Length

    • 88

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04527 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C447H673N141O133S7

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • N

    • Mass

    • 10374.55

    • PI

    • 8.63

    • Basic Residues

    • 13

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +6

    • Boman Index

    • -246.66

    • Hydrophobicity

    • -0.863

    • Aliphatic Index

    • 53.3

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18825

    • Absorbance 280nm

    • 216.38

    • Polar Residues

    • 35

DRAMP04527

DRAMP04527 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and cDNA cloning of luxuriosin, a novel antibacterial peptide with Kunitz domain from the longicorn beetle, Acalolepta luxuriosa.

    • Reference

    • Biochim Biophys Acta. 2005 Feb 11;1722(1):36-42.

    • Author

    • Ueda K, Saito A, Imamura M, Miura N, Atsumi S, Tabunoki H, Watanabe A, Kitami M, Sato R.