• DRAMP ID

    • DRAMP04527
    • Peptide Name

    • Luxuriosin
    • Source

    • Acalolepta luxuriosa (longicorn beetle)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • SVRTQDNAVNRQIFGSNGPYRDFQLSDCYLPLETNPYCNEWQFAYHWNNALMDCERAIYHGCNRTRNNFITLTACKNQAGPICNRRRH
    • Sequence Length

    • 88
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04527 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04527.
    • Formula

    • C447H673N141O133S7
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • N
    • Mass

    • 10374.55
    • PI

    • 8.63
    • Basic Residues

    • 13
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 23
    • Net Charge

    • +6
    • Boman Index

    • -246.66
    • Hydrophobicity

    • -0.863
    • Aliphatic Index

    • 53.3
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 18825
    • Absorbance 280nm

    • 216.38
    • Polar Residues

    • 35

DRAMP04527

DRAMP04527 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Purification and cDNA cloning of luxuriosin, a novel antibacterial peptide with Kunitz domain from the longicorn beetle, Acalolepta luxuriosa.
    • Reference

    • Biochim Biophys Acta. 2005 Feb 11;1722(1):36-42.
    • Author

    • Ueda K, Saito A, Imamura M, Miura N, Atsumi S, Tabunoki H, Watanabe A, Kitami M, Sato R.