General Information

    • DRAMP ID

    • DRAMP04528

    • Peptide Name

    • CrusEs (cDNA encoding crustin-like peptide)

    • Source

    • Chinese mitten crab, Eriocheir sinensis

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • TCRYWCKTPENQTYCCEDEREIPSKVGLKPGKCPPVRPVCPPTRGFFEPPKTCSNDGSCYGADKCCFDRCLGEHVCKPIQTRG

    • Sequence Length

    • 83

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antibacterial, Antifungal, Antiviral, In, Anti-Gram+, Antimicrobial

    • Target Organism

      • Gram-positive bacteria: M. luteus (MIC=0.23 µM), B. subtilis (MIC=0.11 µM), B. thuringiensis (MIC=0.11 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04528 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04528.

Physicochemical Information

    • Formula

    • C398H619N115O120S12

    • Absent Amino Acids

    • M

    • Common Amino Acids

    • CP

    • Mass

    • 9319.71

    • PI

    • 8.26

    • Basic Residues

    • 14

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +4

    • Boman Index

    • -188.31

    • Hydrophobicity

    • -0.78

    • Aliphatic Index

    • 33.98

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10720

    • Absorbance 280nm

    • 130.73

    • Polar Residues

    • 33

DRAMP04528

DRAMP04528 chydropathy plot

Comments Information

    • Function

    • CrusEs is a potent antibacterial protein against Gram-positive bacteria infection.

Literature Information

  • ·Literature 1

    • Title

    • Molecular characterization and expression of a crustin-like gene from Chinese mitten crab, Eriocheir sinensis.

    • Reference

    • Dev Comp Immunol. 2010 Jul;34(7):734-740.

    • Author

    • Mu C, Zheng P, Zhao J, Wang L, Zhang H, Qiu L, Gai Y, Song L.