General Information

    • DRAMP ID

    • DRAMP04529

    • Peptide Name

    • LAP-like antimicrobial peptide (Bovine beta-defensins)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Not found

    • Gene

    • lap-like

    • Sequence

    • FTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK

    • Sequence Length

    • 44

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04529 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04529.

Physicochemical Information

    • Formula

    • C199H348N74O56S7

    • Absent Amino Acids

    • DEHWY

    • Common Amino Acids

    • R

    • Mass

    • 4897.83

    • PI

    • 10.85

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +10

    • Boman Index

    • -120.55

    • Hydrophobicity

    • -0.496

    • Aliphatic Index

    • 57.5

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 8.72

    • Polar Residues

    • 18

DRAMP04529

DRAMP04529 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Bovine beta-defensins: identification and characterization of novel bovine beta-defensin genes and their expression in mammary gland tissue.

    • Reference

    • Mamm Genome. 2004 Oct;15(10):834-842.

    • Author

    • Roosen S, Exner K, Paul S, Schröder JM, Kalm E, Looft C.