General Information

    • DRAMP ID

    • DRAMP04567

    • Peptide Name

    • Centrocin 1

    • Source

    • Strongylocentrotus droebachiensis

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GWFKKTFHKVSHAVKSGIHAGQRGCSALGF

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04567 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C148H225N45O36S

    • Absent Amino Acids

    • DEMNPY

    • Common Amino Acids

    • G

    • Mass

    • 3242.75

    • PI

    • 10.48

    • Basic Residues

    • 8

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +8

    • Boman Index

    • -28.81

    • Hydrophobicity

    • -0.207

    • Aliphatic Index

    • 55.33

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 189.66

    • Polar Residues

    • 10

DRAMP04567

DRAMP04567 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Centrocins: Isolation and characterization of novel dimeric antimicrobial peptides from the green sea urchin, Strongylocentrotus droebachiensis.

    • Reference

    • Dev Comp Immunol. 2010 Sep;34(9):959-968.

    • Author

    • Li C, Haug T, Moe MK, Styrvold OB, Stensvåg K.