• DRAMP ID

    • DRAMP04567
    • Peptide Name

    • Centrocin 1
    • Source

    • Strongylocentrotus droebachiensis
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GWFKKTFHKVSHAVKSGIHAGQRGCSALGF
    • Sequence Length

    • 30
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04567 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04567.
    • Formula

    • C148H225N45O36S
    • Absent Amino Acids

    • DEMNPY
    • Common Amino Acids

    • G
    • Mass

    • 3242.75
    • PI

    • 10.48
    • Basic Residues

    • 8
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +8
    • Boman Index

    • -28.81
    • Hydrophobicity

    • -0.207
    • Aliphatic Index

    • 55.33
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 189.66
    • Polar Residues

    • 10

DRAMP04567

DRAMP04567 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Centrocins: Isolation and characterization of novel dimeric antimicrobial peptides from the green sea urchin, Strongylocentrotus droebachiensis.
    • Reference

    • Dev Comp Immunol. 2010 Sep;34(9):959-968.
    • Author

    • Li C, Haug T, Moe MK, Styrvold OB, Stensvåg K.