• DRAMP ID

    • DRAMP04569
    • Peptide Name

    • Arminin-1a
    • Source

    • Hydra magnipapillata
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • KPWRFRRAIRRVRWRKVAPYIPFVVKTVGKK
    • Sequence Length

    • 31
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04569 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04569.
    • Formula

    • C185H301N59O34
    • Absent Amino Acids

    • CDEHLMNQS
    • Common Amino Acids

    • R
    • Mass

    • 3895.8
    • PI

    • 12.41
    • Basic Residues

    • 12
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +12
    • Boman Index

    • -89.68
    • Hydrophobicity

    • -0.671
    • Aliphatic Index

    • 78.39
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 12490
    • Absorbance 280nm

    • 416.33
    • Polar Residues

    • 3

DRAMP04569

DRAMP04569 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Activity of the novel peptide arminin against multiresistant human pathogens shows the considerable potential of phylogenetically ancient organisms as drug sources.
    • Reference

    • Antimicrob Agents Chemother. 2009 Dec;53(12):5245-5250.
    • Author

    • Augustin R, Anton-Erxleben F, Jungnickel S, Hemmrich G, Spudy B, Podschun R, Bosch TC.