General Information

    • DRAMP ID

    • DRAMP04569

    • Peptide Name

    • Arminin-1a

    • Source

    • Hydra magnipapillata

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KPWRFRRAIRRVRWRKVAPYIPFVVKTVGKK

    • Sequence Length

    • 31

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04569 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C185H301N59O34

    • Absent Amino Acids

    • CDEHLMNQS

    • Common Amino Acids

    • R

    • Mass

    • 3895.8

    • PI

    • 12.41

    • Basic Residues

    • 12

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +12

    • Boman Index

    • -89.68

    • Hydrophobicity

    • -0.671

    • Aliphatic Index

    • 78.39

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 416.33

    • Polar Residues

    • 3

DRAMP04569

DRAMP04569 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Activity of the novel peptide arminin against multiresistant human pathogens shows the considerable potential of phylogenetically ancient organisms as drug sources.

    • Reference

    • Antimicrob Agents Chemother. 2009 Dec;53(12):5245-5250.

    • Author

    • Augustin R, Anton-Erxleben F, Jungnickel S, Hemmrich G, Spudy B, Podschun R, Bosch TC.