General Information

    • DRAMP ID

    • DRAMP04570

    • Peptide Name

    • Callinectin

    • Source

    • Callinectes sapidus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNY

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04570 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04570.

Physicochemical Information

    • Formula

    • C158H244N54O39S4

    • Absent Amino Acids

    • DEHIKLMQT

    • Common Amino Acids

    • R

    • Mass

    • 3652.25

    • PI

    • 10.66

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +6

    • Boman Index

    • -82.18

    • Hydrophobicity

    • -0.509

    • Aliphatic Index

    • 39.38

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7240

    • Absorbance 280nm

    • 233.55

    • Polar Residues

    • 13

DRAMP04570

DRAMP04570 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Primary structure and cellular localization of callinectin; an antimicrobial peptide from the blue crab.

    • Reference

    • Dev Comp Immunol. 2011 Apr;35(4):409-415.

    • Author

    • Noga EJ, Stone KL, Wood A, Gordon WL, Robinette D.