• DRAMP ID

    • DRAMP04571
    • Peptide Name

    • bullfrog pepsinogen C-derived antimicrobial peptide (bPcAP)
    • Source

    • Rana catesbeiana
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • IIKVPLKKFKSMREVMRDHGIKAPVVDPATKY
    • Sequence Length

    • 32
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04571 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04571.
    • Formula

    • C169H284N46O42S2
    • Absent Amino Acids

    • CNQW
    • Common Amino Acids

    • K
    • Mass

    • 3696.52
    • PI

    • 10.12
    • Basic Residues

    • 9
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +6
    • Boman Index

    • -50.08
    • Hydrophobicity

    • -0.306
    • Aliphatic Index

    • 91.25
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 48.06
    • Polar Residues

    • 4

DRAMP04571

DRAMP04571 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Antimicrobial peptides derived from pepsinogens in the stomach of the bullfrog, Rana catesbeiana.
    • Reference

    • Biochim Biophys Acta. 1998 Jul 1;1407(1):31-39.
    • Author

    • Minn I, Kim HS, Kim SC.