• DRAMP ID

    • DRAMP04573
    • Peptide Name

    • Psacotheasin
    • Source

    • Psacothea hilaris
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK
    • Sequence Length

    • 34
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04573 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04573.
    • Formula

    • C143H220N46O44S6
    • Absent Amino Acids

    • DFLMRT
    • Common Amino Acids

    • G
    • Mass

    • 3479.96
    • PI

    • 8.33
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +4
    • Boman Index

    • -30.87
    • Hydrophobicity

    • -0.409
    • Aliphatic Index

    • 34.41
    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 223.18
    • Polar Residues

    • 18

DRAMP04573

DRAMP04573 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Isolation and Characterization of Psacotheasin, a Novel Knottin-Type Antimicrobial Peptide, from Psacothea hilaris.
    • Reference

    • J Microbiol Biotechnol. 2010 Apr;20(4):708-711.
    • Author

    • Hwang JS, Lee J, Hwang B, Nam SH, Yun EY, Kim SR, Lee DG.