General Information

    • DRAMP ID

    • DRAMP04575

    • Peptide Name

    • Chironomus defensin

    • Source

    • Chironomus plumosus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • LTCDILGSTPACAAHCIARGYRGGWCDGQSVCNCRR

    • Sequence Length

    • 36

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04575 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C155H249N53O48S6

    • Absent Amino Acids

    • EFKM

    • Common Amino Acids

    • C

    • Mass

    • 3815.37

    • PI

    • 8.35

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +3

    • Boman Index

    • -60.37

    • Hydrophobicity

    • -0.028

    • Aliphatic Index

    • 62.5

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 210.43

    • Polar Residues

    • 17

DRAMP04575

DRAMP04575 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Isolation, characterization and chemical synthesis of a new insect defensin from Chironomus plumosus (Diptera).

    • Reference

    • Insect Biochem Mol Biol. 1998 Dec;28(12):1059-1066.

    • Author

    • Lauth X, Nesin A, Briand JP, Roussel JP, Hetru C.