• DRAMP ID

    • DRAMP04575
    • Peptide Name

    • Chironomus defensin
    • Source

    • Chironomus plumosus
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • LTCDILGSTPACAAHCIARGYRGGWCDGQSVCNCRR
    • Sequence Length

    • 36
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04575 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04575.
    • Formula

    • C155H249N53O48S6
    • Absent Amino Acids

    • EFKM
    • Common Amino Acids

    • C
    • Mass

    • 3815.37
    • PI

    • 8.35
    • Basic Residues

    • 5
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +3
    • Boman Index

    • -60.37
    • Hydrophobicity

    • -0.028
    • Aliphatic Index

    • 62.5
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 210.43
    • Polar Residues

    • 17

DRAMP04575

DRAMP04575 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Isolation, characterization and chemical synthesis of a new insect defensin from Chironomus plumosus (Diptera).
    • Reference

    • Insect Biochem Mol Biol. 1998 Dec;28(12):1059-1066.
    • Author

    • Lauth X, Nesin A, Briand JP, Roussel JP, Hetru C.