General Information

    • DRAMP ID

    • DRAMP04577

    • Peptide Name

    • Papiliocin

    • Source

    • Papilio xuthus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04577 helical wheel diagram

    • Predicted Structure

Physicochemical Information

    • Formula

    • C183H313N55O45

    • Absent Amino Acids

    • CHLMSY

    • Common Amino Acids

    • V

    • Mass

    • 4003.84

    • PI

    • 11.17

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +7

    • Boman Index

    • -42.26

    • Hydrophobicity

    • 0.095

    • Aliphatic Index

    • 110.54

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 152.78

    • Polar Residues

    • 6

DRAMP04577

DRAMP04577 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterization and cDNA cloning of a cecropin-like antimicrobial peptide, papiliocin, from the swallowtail butterfly, Papilio xuthus.

    • Reference

    • Mol Cells. 2010 Apr;29(4):419-423.

    • Author

    • Kim SR, Hong MY, Park SW, Choi KH, Yun EY, Goo TW, Kang SW, Suh HJ, Kim I, Hwang JS.