General Information

    • DRAMP ID

    • DRAMP04580

    • Peptide Name

    • ECATH-3

    • Source

    • Equus asinus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KRFHSVGSLIQRHQQMIRDKSEATRHGIRIITRPKLLLAS

    • Sequence Length

    • 40

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04580 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04580.

Physicochemical Information

    • Formula

    • C204H350N70O54S

    • Absent Amino Acids

    • CNWY

    • Common Amino Acids

    • R

    • Mass

    • 4679.52

    • PI

    • 12.01

    • Basic Residues

    • 12

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +10

    • Boman Index

    • -111.89

    • Hydrophobicity

    • -0.565

    • Aliphatic Index

    • 100

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 8

DRAMP04580

DRAMP04580 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Novel cathelicidins in horse leukocytes(1).

    • Reference

    • FEBS Lett. 1999 Sep 3;457(3):459-464.

    • Author

    • Scocchi M, Bontempo D, Boscolo S, Tomasinsig L, Giulotto E, Zanetti M.