General Information

    • DRAMP ID

    • DRAMP04581

    • Peptide Name

    • Ap

    • Source

    • Argopecten purpuratus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • TYMPVEEGEYIVNISYADQPKKNSPFTAKKQPGPKVDLSGVKAYGPG

    • Sequence Length

    • 47

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04581 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04581.

Physicochemical Information

    • Formula

    • C231H357N57O71S

    • Absent Amino Acids

    • CHRW

    • Common Amino Acids

    • KP

    • Mass

    • 5100.78

    • PI

    • 7.9

    • Basic Residues

    • 6

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +1

    • Boman Index

    • -65.05

    • Hydrophobicity

    • -0.762

    • Aliphatic Index

    • 55.96

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5960

    • Absorbance 280nm

    • 129.57

    • Polar Residues

    • 16

DRAMP04581

DRAMP04581 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A novel antifungal peptide designed from the primary structure of a natural antimicrobial peptide purified from Argopecten purpuratus hemocytes.

    • Reference

    • Peptides. 2009 Aug;30(8):1405-1411.

    • Author

    • Arenas G, Guzmán F, Cárdenas C, Mercado L, Marshall SH.