• DRAMP ID

    • DRAMP04581
    • Peptide Name

    • Ap
    • Source

    • Argopecten purpuratus
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • TYMPVEEGEYIVNISYADQPKKNSPFTAKKQPGPKVDLSGVKAYGPG
    • Sequence Length

    • 47
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04581 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04581.
    • Formula

    • C231H357N57O71S
    • Absent Amino Acids

    • CHRW
    • Common Amino Acids

    • KP
    • Mass

    • 5100.78
    • PI

    • 7.9
    • Basic Residues

    • 6
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +1
    • Boman Index

    • -65.05
    • Hydrophobicity

    • -0.762
    • Aliphatic Index

    • 55.96
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5960
    • Absorbance 280nm

    • 129.57
    • Polar Residues

    • 16

DRAMP04581

DRAMP04581 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • A novel antifungal peptide designed from the primary structure of a natural antimicrobial peptide purified from Argopecten purpuratus hemocytes.
    • Reference

    • Peptides. 2009 Aug;30(8):1405-1411.
    • Author

    • Arenas G, Guzmán F, Cárdenas C, Mercado L, Marshall SH.