• DRAMP ID

    • DRAMP04582
    • Peptide Name

    • Strongylocin 1 (Cys-rich; sea urchin, Echinoidea, animals)
    • Source

    • Strongylocentrotus droebachiensis
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • IFGSIYHRKCVVKNRCETVSGHKTCKDLTCCRAVIFRHERPEVCRPQT
    • Sequence Length

    • 48
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04582 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04582.
    • Formula

    • C239H392N78O66S6
    • Absent Amino Acids

    • MW
    • Common Amino Acids

    • CR
    • Mass

    • 5606.58
    • PI

    • 9.34
    • Basic Residues

    • 13
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +9
    • Boman Index

    • -127.04
    • Hydrophobicity

    • -0.463
    • Aliphatic Index

    • 64.79
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 39.68
    • Polar Residues

    • 16

DRAMP04582

DRAMP04582 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Strongylocins, novel antimicrobial peptides from the green sea urchin, Strongylocentrotus droebachiensis.
    • Reference

    • Dev Comp Immunol. 2008;32(12):1430-1440.
    • Author

    • Li C, Haug T, Styrvold OB, Jørgensen TØ, Stensvåg K.