General Information

    • DRAMP ID

    • DRAMP04582

    • Peptide Name

    • Strongylocin 1 (Cys-rich; sea urchin, Echinoidea, animals)

    • Source

    • Strongylocentrotus droebachiensis

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • IFGSIYHRKCVVKNRCETVSGHKTCKDLTCCRAVIFRHERPEVCRPQT

    • Sequence Length

    • 48

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04582 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C239H392N78O66S6

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • CR

    • Mass

    • 5606.58

    • PI

    • 9.34

    • Basic Residues

    • 13

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +9

    • Boman Index

    • -127.04

    • Hydrophobicity

    • -0.463

    • Aliphatic Index

    • 64.79

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 39.68

    • Polar Residues

    • 16

DRAMP04582

DRAMP04582 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Strongylocins, novel antimicrobial peptides from the green sea urchin, Strongylocentrotus droebachiensis.

    • Reference

    • Dev Comp Immunol. 2008;32(12):1430-1440.

    • Author

    • Li C, Haug T, Styrvold OB, Jørgensen TØ, Stensvåg K.