General Information

    • DRAMP ID

    • DRAMP04584

    • Peptide Name

    • SpStrongylocin 1 (S. purpuratus Strongylocin, sea urchin, Echinoidea, animals)

    • Source

    • Strongylocentrotus purpuratus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • IFNSIYHRKCVVKNRCETVSGHKTCKDLTCCRAVIFRHERPEVCRPST

    • Sequence Length

    • 48

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04584 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04584.

Physicochemical Information

    • Formula

    • C239H392N78O67S6

    • Absent Amino Acids

    • MQW

    • Common Amino Acids

    • CR

    • Mass

    • 5622.58

    • PI

    • 9.34

    • Basic Residues

    • 13

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +9

    • Boman Index

    • -132.48

    • Hydrophobicity

    • -0.471

    • Aliphatic Index

    • 64.79

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 39.68

    • Polar Residues

    • 17

DRAMP04584

DRAMP04584 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Two recombinant peptides, SpStrongylocins 1 and 2, from Strongylocentrotus purpuratus, show antimicrobial activity against Gram-positive and Gram-negative bacteria.

    • Reference

    • Dev Comp Immunol. 2010 Mar;34(3):286-292.

    • Author

    • Li C, Blencke HM, Smith LC, Karp MT, Stensvåg K.