General Information

    • DRAMP ID

    • DRAMP04586

    • Peptide Name

    • Vejovine

    • Source

    • Vaejovis mexicanus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAASMTLDEIVDAMYYD

    • Sequence Length

    • 60

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04586 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C284H450N76O90S2

    • Absent Amino Acids

    • CH

    • Common Amino Acids

    • A

    • Mass

    • 6433.27

    • PI

    • 6.23

    • Basic Residues

    • 6

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 24

    • Net Charge

    • 0

    • Boman Index

    • -71.15

    • Hydrophobicity

    • -0.113

    • Aliphatic Index

    • 88

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 13980

    • Absorbance 280nm

    • 236.95

    • Polar Residues

    • 19

DRAMP04586

DRAMP04586 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Vejovine, a new antibiotic from the scorpion venom of Vaejovis mexicanus.

    • Reference

    • Toxicon. 2011 Jan;57(1):84-92.

    • Author

    • Hernández-Aponte CA, Silva-Sanchez J, Quintero-Hernández V, Rodríguez-Romero A, Balderas C, Possani LD, Gurrola GB.