• DRAMP ID

    • DRAMP04590
    • Peptide Name

    • Rhamp
    • Source

    • Rhipicephalus haemaphysaloides
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • ERILDLRKTKKSCKNGEVLGCVSGHGPPGCSENECGMGPRPKACFFDCHYGCWCTGKLYRRKRDRKCVPKHECLL
    • Sequence Length

    • 75
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04590 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04590.
    • Formula

    • C361H582N114O101S11
    • Absent Amino Acids

    • Q
    • Common Amino Acids

    • CGK
    • Mass

    • 8487.96
    • PI

    • 9.13
    • Basic Residues

    • 19
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +11
    • Boman Index

    • -177.21
    • Hydrophobicity

    • -0.745
    • Aliphatic Index

    • 49.33
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 9105
    • Absorbance 280nm

    • 123.04
    • Polar Residues

    • 28

DRAMP04590

DRAMP04590 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Identification of a cysteine-rich antimicrobial peptide from salivary glands of the tick Rhipicephalus haemaphysaloides.
    • Reference

    • Peptides. 2011 Mar;32(3):441-446.
    • Author

    • Zhang H, Zhang W, Wang X, Zhou Y, Wang N, Zhou J.