General Information

    • DRAMP ID

    • DRAMP04591

    • Peptide Name

    • CXCL14

    • Source

    • Homo sapiens

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

    • Sequence Length

    • 77

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04591 helical wheel diagram

    • Predicted Structure

Physicochemical Information

    • Formula

    • C418H672N124O112S6

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • K

    • Mass

    • 9419.06

    • PI

    • 9.9

    • Basic Residues

    • 24

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +16

    • Boman Index

    • -233.93

    • Hydrophobicity

    • -1.24

    • Aliphatic Index

    • 51.82

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18700

    • Absorbance 280nm

    • 246.05

    • Polar Residues

    • 22

DRAMP04591

DRAMP04591 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Potent and broad-spectrum antimicrobial activity of CXCL14 suggests an immediate role in skin infections.

    • Reference

    • J Immunol. 2009 Jan 1;182(1):507-514.

    • Author

    • Maerki C, Meuter S, Liebi M, Mühlemann K, Frederick MJ, Yawalkar N, Moser B, Wolf M.