• DRAMP ID

    • DRAMP04591
    • Peptide Name

    • CXCL14
    • Source

    • Homo sapiens
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
    • Sequence Length

    • 77
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04591 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP04591.
    • Formula

    • C418H672N124O112S6
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • K
    • Mass

    • 9419.06
    • PI

    • 9.9
    • Basic Residues

    • 24
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +16
    • Boman Index

    • -233.93
    • Hydrophobicity

    • -1.24
    • Aliphatic Index

    • 51.82
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 18700
    • Absorbance 280nm

    • 246.05
    • Polar Residues

    • 22

DRAMP04591

DRAMP04591 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Potent and broad-spectrum antimicrobial activity of CXCL14 suggests an immediate role in skin infections.
    • Reference

    • J Immunol. 2009 Jan 1;182(1):507-514.
    • Author

    • Maerki C, Meuter S, Liebi M, Mühlemann K, Frederick MJ, Yawalkar N, Moser B, Wolf M.