General Information

    • DRAMP ID

    • DRAMP04592

    • Peptide Name

    • Ls-Stylicin 1

    • Source

    • Litopenaeus stylirostris

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SSFSPPRGPPGWGPPCVQQPCPKCPYDDYKCPTCDKFPECEECPHISIGCECGYFSCECPKPVCEPCESPIAELIKKGGYKG

    • Sequence Length

    • 82

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04592 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C390H581N97O118S13

    • Absent Amino Acids

    • MN

    • Common Amino Acids

    • P

    • Mass

    • 8933.26

    • PI

    • 5

    • Basic Residues

    • 9

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 12

    • Net Charge

    • -2

    • Boman Index

    • -103.76

    • Hydrophobicity

    • -0.585

    • Aliphatic Index

    • 32.07

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12210

    • Absorbance 280nm

    • 150.74

    • Polar Residues

    • 32

DRAMP04592

DRAMP04592 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Stylicins, a new family of antimicrobial peptides from the Pacific blue shrimp Litopenaeus stylirostris.

    • Reference

    • Mol Immunol. 2010 Mar;47(6):1269-1277.

    • Author

    • Rolland JL, Abdelouahab M, Dupont J, Lefevre F, Bachère E, Romestand B.