• DRAMP ID

    • DRAMP04593
    • Peptide Name

    • CrusSp
    • Source

    • Scylla paramamosain
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • RVPPYLGRDCKHWCRDNNQALYCCGPPGITYPPFIRKHPGKCPSVRSTCTGVRSSRPKFCPHDDACEFRSKCCYDACVKHHVCKTVEFY
    • Sequence Length

    • 89
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04593 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04593.
    • Formula

    • C445H678N134O121S12
    • Absent Amino Acids

    • M
    • Common Amino Acids

    • C
    • Mass

    • 10225.82
    • PI

    • 8.99
    • Basic Residues

    • 20
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 18
    • Net Charge

    • +13
    • Boman Index

    • -201.87
    • Hydrophobicity

    • -0.653
    • Aliphatic Index

    • 40.45
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 13700
    • Absorbance 280nm

    • 155.68
    • Polar Residues

    • 33

DRAMP04593

DRAMP04593 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Molecular cloning and characterization of crustin from mud crab Scylla paramamosain.
    • Reference

    • Mol Biol Rep. 2009 May;36(5):841-850.
    • Author

    • Imjongjirak C, Amparyup P, Tassanakajon A, Sittipraneed S.