General Information

    • DRAMP ID

    • DRAMP04593

    • Peptide Name

    • CrusSp

    • Source

    • Scylla paramamosain

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RVPPYLGRDCKHWCRDNNQALYCCGPPGITYPPFIRKHPGKCPSVRSTCTGVRSSRPKFCPHDDACEFRSKCCYDACVKHHVCKTVEFY

    • Sequence Length

    • 89

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04593 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C445H678N134O121S12

    • Absent Amino Acids

    • M

    • Common Amino Acids

    • C

    • Mass

    • 10225.82

    • PI

    • 8.99

    • Basic Residues

    • 20

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +13

    • Boman Index

    • -201.87

    • Hydrophobicity

    • -0.653

    • Aliphatic Index

    • 40.45

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 13700

    • Absorbance 280nm

    • 155.68

    • Polar Residues

    • 33

DRAMP04593

DRAMP04593 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning and characterization of crustin from mud crab Scylla paramamosain.

    • Reference

    • Mol Biol Rep. 2009 May;36(5):841-850.

    • Author

    • Imjongjirak C, Amparyup P, Tassanakajon A, Sittipraneed S.