General Information

    • DRAMP ID

    • DRAMP04595

    • Peptide Name

    • Prolixicin

    • Source

    • Rhodnius prolixus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SPRPDDKKNQGSASVDVQNERGEGTKVDARVRQELWRSDDGRTRAQAYGHWDRTYGGRNHGERSYGGGMRIEHTWGN

    • Sequence Length

    • 77

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04595 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04595.

Physicochemical Information

    • Formula

    • C365H564N130O122S

    • Absent Amino Acids

    • CF

    • Common Amino Acids

    • GR

    • Mass

    • 8757.35

    • PI

    • 9.29

    • Basic Residues

    • 17

    • Acidic Residues

    • 12

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +5

    • Boman Index

    • -312.4

    • Hydrophobicity

    • -1.662

    • Aliphatic Index

    • 30.39

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 20970

    • Absorbance 280nm

    • 275.92

    • Polar Residues

    • 28

DRAMP04595

DRAMP04595 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Prolixicin: a novel antimicrobial peptide isolated from Rhodnius prolixus with differential activity against bacteria and Trypanosoma cruzi.

    • Reference

    • Insect Mol Biol. 2011 Dec;20(6):775-786.

    • Author

    • Ursic-Bedoya R, Buchhop J, Joy JB, Durvasula R, Lowenberger C.