General Information

    • DRAMP ID

    • DRAMP04611

    • Peptide Name

    • Cg-Defh1

    • Source

    • Crassostrea gigas

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GFGCPRDQYKCNSHCQSIGCRAGYCDAVTLWLRCTCTDCNGKK

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04611 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04611.

Physicochemical Information

    • Formula

    • C196H306N62O61S8

    • Absent Amino Acids

    • EM

    • Common Amino Acids

    • C

    • Mass

    • 4763.44

    • PI

    • 8.5

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +4

    • Boman Index

    • -88.71

    • Hydrophobicity

    • -0.488

    • Aliphatic Index

    • 38.6

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 213.81

    • Polar Residues

    • 22

DRAMP04611

DRAMP04611 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Expression, tissue localization and synergy of antimicrobial peptides and proteins in the immune response of the oyster Crassostrea gigas.

    • Reference

    • Dev Comp Immunol. 2012 Jul;37(3-4):363-370.

    • Author

    • Schmitt P, de Lorgeril J, Gueguen Y, Destoumieux-Garzón D, Bachère E.