• DRAMP ID

    • DRAMP04612
    • Peptide Name

    • Cg-Defh2
    • Source

    • Crassostrea gigas
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GFGCPGDQYECNRHCRSIGCRAGYCDAVTLWLRCTCTGCSGKK
    • Sequence Length

    • 43
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04612 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04612.
    • Formula

    • C192H300N62O59S8
    • Absent Amino Acids

    • M
    • Common Amino Acids

    • C
    • Mass

    • 4677.35
    • PI

    • 8.51
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +4
    • Boman Index

    • -82.11
    • Hydrophobicity

    • -0.358
    • Aliphatic Index

    • 38.6
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8980
    • Absorbance 280nm

    • 213.81
    • Polar Residues

    • 23

DRAMP04612

DRAMP04612 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Expression, tissue localization and synergy of antimicrobial peptides and proteins in the immune response of the oyster Crassostrea gigas.
    • Reference

    • Dev Comp Immunol. 2012 Jul;37(3-4):363-370.
    • Author

    • Schmitt P, de Lorgeril J, Gueguen Y, Destoumieux-Garzón D, Bachère E.