General Information

    • DRAMP ID

    • DRAMP04670

    • Peptide Name

    • PBD1-42

    • Source

    • Boletus edulis

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KNIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK

    • Sequence Length

    • 42

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.23220638]Gram-negative bacterium: Escherichia coli (MIC=100 µg/mL);
      • Gram-positive bacterium: Staphylococcus aureus (MIC=80 µg/mL).

    • Hemolytic Activity

      • [Ref.23220638]5% hemolytic activity at 10 μg/mL, 10% hemolytic activity at 20 μg/mL, 10% hemolytic activity at 100 μg/mL against porcine fresh blood

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04670 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04670.

Physicochemical Information

    • Formula

    • C186H331N61O51S9

    • Absent Amino Acids

    • DEFHWY

    • Common Amino Acids

    • K

    • Mass

    • 4526.59

    • PI

    • 9.92

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +10

    • Boman Index

    • -66.49

    • Hydrophobicity

    • -0.45

    • Aliphatic Index

    • 50.95

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 9.15

    • Polar Residues

    • 17

DRAMP04670

DRAMP04670 chydropathy plot

Comments Information

    • Function

    • The recombinant pBD142 exhibited antimicrobial activity against both Gram-positive Staphylococcus aureus and Gram-negative E. coli including the multi-resistant E. coli. Shows hemolytic activity and high thermal stability.

Literature Information

  • ·Literature 1

    • Title

    • Cloning, expression and characterization of antimicrobial porcine b defensin 1 in Escherichia coli.

    • Reference

    • Protein Expr Purif. 2013 Mar;88(1):47-53.

    • Author

    • Li CL, Xu TT, Chen RB, Huang XX, Zhao YC, Bao YY, Zhao WD, Zheng ZY.