General Information

    • DRAMP ID

    • DRAMP04671

    • Peptide Name

    • Myticusin-1

    • Source

    • Mytilus coruscus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • TDHQMAQSACIGVSQDNAYASAIPRDCHGG

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacteria: Escherichia coli (MIC=6.7-12.5 µM), Vibrio Parahaemolyticus (MIC>25.0 µM), Pseudomonas aeruginosa (MIC>25.0 µM), Vibrio.harveyi (MIC=12.5-25.0 µM).
      • Gram-positive bacteria: Bacillus subtilis (MIC=1.2-2.5 µM), Staphylococcus aureus (MIC=2.5-5.0 µM), Sarcina luteus (MIC=1.2-2.5 µM), Bacillus megaterium (MIC=2.5-5.0 µM).
      • Fungi: Candida albicans (MIC=6.7-12.5 µM), Monilia albican (MIC=12.5-25.0 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04671 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04671.

Physicochemical Information

    • Formula

    • C125H195N41O46S3

    • Absent Amino Acids

    • EFKLW

    • Common Amino Acids

    • A

    • Mass

    • 3104.35

    • PI

    • 5.12

    • Basic Residues

    • 3

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 8

    • Net Charge

    • 0

    • Boman Index

    • -55.91

    • Hydrophobicity

    • -0.45

    • Aliphatic Index

    • 52.33

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 55.69

    • Polar Residues

    • 11

DRAMP04671

DRAMP04671 chydropathy plot

Comments Information

    • Function

    • Myticusin-1 exhibites stronger anti-microbial properties against Gram-positive bacteria more than Gram-negative bacteria and fungus.

Literature Information

  • ·Literature 1

    • Title

    • Molecular characterization of a novel antimicrobial peptide from Mytilus coruscus.

    • Reference

    • Fish Shellfish Immunol. 2013 Feb;34(2):610-616.

    • Author

    • Liao Z, Wang XC, Liu HH, Fan MH, Sun JJ, Shen W.