General Information

    • DRAMP ID

    • DRAMP04675

    • Peptide Name

    • Antimicrobial defensin peptide DRR230-c

    • Source

    • Pisum sativum (Garden pea)

    • Family

    • Not found

    • Gene

    • DRR230-c

    • Sequence

    • ALSFLFLFLFVAQEIVVTEANTCEHLADTYRGVCFTDASCDDHCKNKAHLISGTCHNFKC

    • Sequence Length

    • 60

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04675 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04675.

Physicochemical Information

    • Formula

    • C296H448N78O88S6

    • Absent Amino Acids

    • MPW

    • Common Amino Acids

    • ACFLT

    • Mass

    • 6699.64

    • PI

    • 5.65

    • Basic Residues

    • 8

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +1

    • Boman Index

    • -60.35

    • Hydrophobicity

    • 0.262

    • Aliphatic Index

    • 81.33

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 31.61

    • Polar Residues

    • 20

DRAMP04675

DRAMP04675 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Analysis of the DRR230 family of pea defensins: gene expression pattern and evidence of broad host-range antifungal activity.

    • Reference

    • Plant Sci. 2002, 163:855-864.

    • Author

    • Lai FM, DeLong C, Mei K, Wignes T, Fobert PR.
  • ·Literature 2

    • Title

    • Reference

    • Author