General Information

    • DRAMP ID

    • DRAMP04678

    • Peptide Name

    • Defensin-like protein 4

    • Source

    • Brassica napus (Rape)

    • Family

    • Belongs to the DEFL family (RTI/MTI-2 subfamily)

    • Gene

    • Not found

    • Sequence

    • DSECLKEYGGDVGFGFCAPRIYPSFCVQRCRADKGALSGKCIWGQGSNVKCLCNFCRHEP

    • Sequence Length

    • 60

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04678 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04678.

Physicochemical Information

    • Formula

    • C285H435N83O83S8

    • Absent Amino Acids

    • MT

    • Common Amino Acids

    • CG

    • Mass

    • 6608.58

    • PI

    • 8.19

    • Basic Residues

    • 9

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +3

    • Boman Index

    • -9721

    • Hydrophobicity

    • -0.282

    • Aliphatic Index

    • 52

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 152.2

    • Polar Residues

    • 24

DRAMP04678

DRAMP04678 chydropathy plot

Comments Information

    • Function

    • Inhibits trypsin and chymotrypsin.

Literature Information

  • ·Literature 1

    • Title

    • Purification, inhibitory properties, amino acid sequence and identification of the reactive site of a new serine proteinase inhibitor from oil-rape (Brassica napus) seed.

    • Reference

    • FEBS Lett. 1994 Apr 4;342(2):221-224.

    • Author

    • Ceciliani F, Bortolotti F, Menegatti E, Ronchi S, Ascenzi P, Palmieri S.