General Information

    • DRAMP ID

    • DRAMP04682

    • Peptide Name

    • Lactogenin

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the pancreatic ribonuclease family

    • Gene

    • Not found

    • Sequence

    • QGRMYQRFLRQHVDPDETGGNDHYLNLSRRNIQCPNRHEGVRFNTDIHEDLTNRRPIDEHEGVVRVTDKTEEG

    • Sequence Length

    • 73

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04682 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04682.

Physicochemical Information

    • Formula

    • C364H572N124O120S2

    • Absent Amino Acids

    • AW

    • Common Amino Acids

    • R

    • Mass

    • 8669.42

    • PI

    • 5.91

    • Basic Residues

    • 16

    • Acidic Residues

    • 14

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +2

    • Boman Index

    • -10000

    • Hydrophobicity

    • -1.415

    • Aliphatic Index

    • 57.26

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 41.39

    • Polar Residues

    • 21

DRAMP04682

DRAMP04682 chydropathy plot

Comments Information

    • Function

    • Secretory RNase specific towards pyrimidine bases, with higher activity towards poly C than poly U. Inhibits cell-free translation.

    • Miscellaneous

    • Inhibits HIV-1 reverse transcriptase in vitro.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of angiogenin-1 and a novel protein designated lactogenin from bovine milk.

    • Reference

    • Biochem Biophys Res Commun. 1999 Sep 16;263(1):187-191.

    • Author

    • Ye XY, Cheng KJ, Ng TB.