General Information

    • DRAMP ID

    • DRAMP04688

    • Peptide Name

    • Glucan endo-1,3-beta-glucosidase

    • Source

    • Vitis rotundifolia (Muscadine grape)

    • Family

    • Belongs to the glycosyl hydrolase 17 family

    • Gene

    • Not found

    • Sequence

    • NIFNAISAAGLGNQIKVSTAIDTGVLGTSYPPSK

    • Sequence Length

    • 34

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04688 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04688.

Physicochemical Information

    • Formula

    • C151H246N40O49

    • Absent Amino Acids

    • CEHMRW

    • Common Amino Acids

    • AGIS

    • Mass

    • 3405.85

    • PI

    • 8.5

    • Basic Residues

    • 2

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +1

    • Boman Index

    • -1515

    • Hydrophobicity

    • 0.215

    • Aliphatic Index

    • 97.65

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 45.15

    • Polar Residues

    • 15

DRAMP04688

DRAMP04688 chydropathy plot

Comments Information

    • Function

    • Is thought to be an important plant defense-related product against fungal pathogens.

    • Miscellaneous

    • On the 2D-gel the determined pI of this protein is

Literature Information

  • ·Literature 1

    • Title

    • Proteomics approach to identify unique xylem sap proteins in Pierce's disease-tolerant Vitis species.

    • Reference

    • Appl Biochem Biotechnol. 2010 Mar;160(3):932-944.

    • Author

    • Basha SM, Mazhar H, Vasanthaiah HK.