General Information

    • DRAMP ID

    • DRAMP04689

    • Peptide Name

    • Allergen Fra a 1

    • Source

    • Fragaria ananassa (Strawberry)

    • Family

    • Belongs to the BetVI family

    • Gene

    • Not found

    • Sequence

    • AFVLDADNLIPKKITFGEGSQYGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN

    • Sequence Length

    • 100

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04689 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04689.

Physicochemical Information

    • Formula

    • C502H789N125O159

    • Absent Amino Acids

    • CMRW

    • Common Amino Acids

    • K

    • Mass

    • 11119.53

    • PI

    • 5.78

    • Basic Residues

    • 18

    • Acidic Residues

    • 17

    • Hydrophobic Residues

    • 31

    • Net Charge

    • +1

    • Boman Index

    • -10000

    • Hydrophobicity

    • -0.56

    • Aliphatic Index

    • 82.9

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8940

    • Absorbance 280nm

    • 90.3

    • Polar Residues

    • 30

DRAMP04689

DRAMP04689 chydropathy plot

Comments Information

    • Function

    • May be involved in ripening of fruits.

Literature Information

  • ·Literature 1

    • Title

    • Bet v 1 homologues in strawberry identified as IgE-binding proteins and presumptive allergens.

    • Reference

    • Allergy. 2004 Dec;59(12):1277-1284.

    • Author

    • Karlsson AL, Alm R, Ekstrand B, Fjelkner-Modig S, Schiött A, Bengtsson U, Björk L, Hjernø K, Roepstorff P, Emanuelsson CS.