General Information

    • DRAMP ID

    • DRAMP04691

    • Peptide Name

    • Parigidin-br1

    • Source

    • Palicourea rigida

    • Family

    • Belongs to the cyclotide family (Bracelet subfamily)

    • Gene

    • Not found

    • Sequence

    • GGSVPCGESCVFIPCITSLAGCSCKNKVCYYD

    • Sequence Length

    • 32

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Toxin

    • Target Organism

    • [Swiss_Prot Entry B3EWF1]No antibacterial activity against E.coli strain ATCC 8739 and S.aureus strain ATCC 25923

    • Hemolytic Activity

      • [Ref.22074926] It has 28% and 41% hemolysis at 20 μM and 40 μM against human red blood cells.

    • Cytotoxicity

      • [Ref.22074926] It exhibited cytotoxic effects on SF-9 cells with CC50 values to be 1.7 μm at 24 h, 10.3 μm at 48 h and 73.1 μm at 72 h.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys6 and Cys22,Cys10 and Cys24,Cys15 and Cys29.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04691 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04691.

Physicochemical Information

    • Formula

    • C140H219N35O45S6

    • Absent Amino Acids

    • HMQRW

    • Common Amino Acids

    • C

    • Mass

    • 3304.85

    • PI

    • 6.03

    • Basic Residues

    • 2

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • 0

    • Boman Index

    • -661

    • Hydrophobicity

    • 0.481

    • Aliphatic Index

    • 66.88

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 108.23

    • Polar Residues

    • 18

DRAMP04691

DRAMP04691 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism. Reduces growth of and increases mortality in larvae of D.saccharalis. Kills cultured SF-9 cells of S.frugiperda probably by disrupting plasma membranes. Has hemolytic activity against human erythrocytes. Has no antibacterial activity against E.coli strain ATCC 8739 and S.aureus strain ATCC 25923.

    • Tissue specificity

    • Expressed in leaves, flowers, peduncles and seeds (at protein level).

    • PTM

    • This is a cyclic peptide.

Literature Information

  • ·Literature 1

    • Title

    • Identification and structural characterization of novel cyclotide with activity against an insect pest of sugar cane.

    • Reference

    • J Biol Chem. 2012 Jan 2;287(1):134-147.

    • Author

    • Pinto MF, Fensterseifer IC, Migliolo L, Sousa DA, de Capdville G, Arboleda-Valencia JW, Colgrave ML, Craik DJ, Magalhães BS, Dias SC, Franco OL.