• DRAMP ID

    • DRAMP04692
    • Peptide Name

    • Major pollen allergen Que a 1 (Que a 1; Plant defensin)
    • Source

    • Quercus alba (White oak)
    • Family

    • Belongs to the BetVI family
    • Gene

    • Not found
    • Sequence

    • GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP
    • Sequence Length

    • 50
    • Protein Existence

    • Protein level
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • IgE
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04692 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04692.
    • Formula

    • C242H389N63O75
    • Absent Amino Acids

    • CMWY
    • Common Amino Acids

    • ILAEGS
    • Mass

    • 5381.13
    • PI

    • 5.01
    • Basic Residues

    • 5
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 20
    • Net Charge

    • -1
    • Boman Index

    • -5086
    • Hydrophobicity

    • 0.002
    • Aliphatic Index

    • 103.4
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 13

DRAMP04692

DRAMP04692 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Purification and characterization of the major oak pollen allergenQue a 1 for use in component resolved diagnostics using ImmunoCAP.
    • Reference

    • Allergy, 2008,146:203-211.
    • Author

    • Moverare R., Everberg H., Carlsson R., Holtz A., Thunberg R., Olsson P., Brostedt P., Hoegbom E.