General Information

    • DRAMP ID

    • DRAMP04693

    • Peptide Name

    • Luffin P1c (one chain of ribosome-inactivating protein luffin P1; Plant defensin)

    • Source

    • Luffa aegyptiaca (Sponge gourd) (Luffa cylindrica)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GSPRTEYEACRVRCQVAEHGVERQRRCQQVCEKRLREREGRRE

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral, Toxin

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.21195767] It exhibited ytotoxicity against uninfected C8166 cell line (IC50=235 μM). EC50 of the inhibition of syncytia formation and p24 antigen production were 50 μM (262 μg/ml) and 58 μM (306 μg/ml).

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys10 and Cys31,Cys14 and Cys27.

    • Stereochemistry

    • L

    • Structure

    • Alpha helix

    • Structure Description

    • Nuclear magnetic resonance spectroscopy revealed that the Luffin P1 comprises a helix-loop-helix motif, with the two alpha helices tightly associated by two disulfide bonds.(Ref.2)

    • Helical Wheel Diagram

    • DRAMP04693 helical wheel diagram

    • PDB ID

    • 2L37 resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP04693.

Physicochemical Information

    • Formula

    • C229H388N90O73S4

    • Absent Amino Acids

    • FIMNW

    • Common Amino Acids

    • R

    • Mass

    • 5230.87

    • PI

    • 9.3

    • Basic Residues

    • 14

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +5

    • Boman Index

    • -10000

    • Hydrophobicity

    • -1.604

    • Aliphatic Index

    • 43.4

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 1740

    • Absorbance 280nm

    • 37.83

    • Polar Residues

    • 10

DRAMP04693

DRAMP04693 chydropathy plot

Comments Information

    • Function

    • Inhibits protein synthesis in animal cells.

Literature Information

  • ·Literature 1

    • Title

    • Primary structure of 6.5k-arginine/glutamate-rich polypeptide from the seeds of sponge gourd (Luffa cylindrica).

    • Reference

    • Biosci Biotechnol Biochem. 1997 Jun;61(6):984-988.

    • Author

    • Kimura M, Park SS, Sakai R, Yamasaki N, Funatsu G.
  • ·Literature 2

    • Title

    • Structural characterization and anti-HIV-1 activities of arginine/glutamate-rich polypeptide Luffin P1 from the seeds of sponge gourd (Luffa cylindrica).

    • Reference

    • J Struct Biol. 2011 Apr;174(1):164-172.

    • Author

    • Ng YM, Yang Y, Sze KH, Zhang X, Zheng YT, Shaw PC.