General Information

    • DRAMP ID

    • DRAMP04694

    • Peptide Name

    • Ribosome-inactivating protein saporin-1 (SAP-1; SO-4; rRNA N-glycosidase; Plant defense)

    • Source

    • Saponaria officinalis (Common soapwort) (Lychnis saponaria)

    • Family

    • Belongs to the ribosome-inactivating protein family (Type 1 RIP subfamily)

    • Gene

    • SAP1

    • Sequence

    • VIIYELNLQGTTKAQYSTILKQLRDDIKDPNLXYGXXDYS

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Toxin

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04694 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04694.

Physicochemical Information

    • Formula

    • C193H300N48O59

    • Absent Amino Acids

    • CFHMW

    • Common Amino Acids

    • L

    • Mass

    • 4624.83

    • PI

    • 4.78

    • Basic Residues

    • 4

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 11

    • Net Charge

    • -1

    • Boman Index

    • -6622

    • Hydrophobicity

    • -0.488

    • Aliphatic Index

    • 97.5

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5960

    • Absorbance 280nm

    • 152.82

    • Polar Residues

    • 13

DRAMP04694

DRAMP04694 chydropathy plot

Comments Information

    • Function

    • Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • N-terminal sequence of some ribosome-inactivating proteins.

    • Reference

    • Int J Pept Protein Res. 1989 Apr;33(4):263-267.

    • Author

    • Montecucchi PC, Lazzarini AM, Barbieri L, Stirpe F, Soria M, Lappi D.