General Information

    • DRAMP ID

    • DRAMP04700

    • Peptide Name

    • Basic phospholipase A2 BnpTX-1 (BnPTx-I, svPLA2; Phosphatidylcholine 2-acylhydrolase)

    • Source

    • Bothrops pauloensis (Neuwied's lancehead) (Bothrops neuwiedipauloensis)

    • Family

    • Belongs to the phospholipase A2 family (Group II subfamily D49 sub-subfami

    • Gene

    • Not found

    • Sequence

    • DLWQFGKMILKVAGKLPFPYYGAYGCYCGWGGRGKPKDPTDRCCFVHDCC

    • Sequence Length

    • 50

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiparasitic, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: E. coli ATCC29648 and Gram-positive bacterium: S. aureus ATCC 25923.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04700 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04700.

Physicochemical Information

    • Formula

    • C257H374N66O65S7

    • Absent Amino Acids

    • ENS

    • Common Amino Acids

    • G

    • Mass

    • 5652.62

    • PI

    • 8.61

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +4

    • Boman Index

    • -4327

    • Hydrophobicity

    • -0.266

    • Aliphatic Index

    • 46.8

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17335

    • Absorbance 280nm

    • 353.78

    • Polar Residues

    • 19

DRAMP04700

DRAMP04700 chydropathy plot

Comments Information

    • Function

    • Snake venom phospholipase A2 (PLA2). In vitro, shows anticoagulant activity and induces cytotoxicity when tested on C2C12 myoblasts/myotubes. In vivo, when tested on mice, induces myotoxicity (intramuscular injection), edema (injection in the subplantar region) and lethality. Also induces neurotoxic effect on mouse neuromuscular preparations and has bactericidal activity on the Gram-negative bacteria E.coli (ATCC29648) and the Gram- positive S.aureus (ATCC 25923). The catalytic and anticoagulant activities of BnpTX-I are higher than those of BnpTX-II. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

    • Toxic Dose

    • LD(50) is 5.1 +/- 1.3 mg/kg by intraperitoneal injection into mice. LD(50) is 2.3 +/- 0.8 mg/kg by intravenous injection into mice.

    • Miscellaneous

    • Has a pI of approximately 7.8 and about 121 amino acids (PubMed

    • PTM

    • Contains seven disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Bactericidal and neurotoxic activities of two myotoxic phospholipases A2 from Bothrops neuwiedi pauloensis snake venom.

    • Reference

    • Toxicon. 2004 Sep 1;44(3):305-314.

    • Author

    • Rodrigues VM, Marcussi S, Cambraia RS, de Araújo AL, Malta-Neto NR, Hamaguchi A, Ferro EA, Homsi-Brandeburgo MI, Giglio JR, Soares AM.