General Information

    • DRAMP ID

    • DRAMP04701

    • Peptide Name

    • Phospholipase A2 homolog (BmarPLA2, svPLA2 homolog)

    • Source

    • Bothrops marajoensis (Marajo lancehead)

    • Family

    • Belongs to the phospholipase A2 family (Group II subfamily)

    • Gene

    • Not found

    • Sequence

    • SLLELGKMILQETGKMPSKSYGAYGCNCGVLGR

    • Sequence Length

    • 33

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiparasitic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04701 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04701.

Physicochemical Information

    • Formula

    • C151H251N41O46S4

    • Absent Amino Acids

    • DFHW

    • Common Amino Acids

    • G

    • Mass

    • 3505.14

    • PI

    • 8.77

    • Basic Residues

    • 4

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +2

    • Boman Index

    • -2215

    • Hydrophobicity

    • -0.049

    • Aliphatic Index

    • 82.73

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3105

    • Absorbance 280nm

    • 97.03

    • Polar Residues

    • 15

DRAMP04701

DRAMP04701 chydropathy plot

Comments Information

    • Function

    • Snake phospholipase A2 homolog that lacks enzymatic activity. May display myotoxin activity. Does not show antimicrobial activity.

    • PTM

    • Contains seven disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Antibacterial and antiparasitic effects of Bothrops marajoensis venom and its fractions: Phospholipase A2 and L-amino acid oxidase.

    • Reference

    • Toxicon. 2010 Apr 1;55(4):795-804.

    • Author

    • Costa Torres AF, Dantas RT, Toyama MH, Diz Filho E, Zara FJ, Rodrigues de Queiroz MG, Pinto Nogueira NA, Rosa de Oliveira M, de Oliveira Toyama D, Monteiro HS, Martins AM.