• DRAMP ID

    • DRAMP04703
    • Peptide Name

    • Crotamine CRO1
    • Source

    • Crotalus durissus terrificus (South American rattlesnake)
    • Family

    • Belongs to the crotamine-myotoxin family
    • Gene

    • CRO1
    • Sequence

    • YKQCHKKGGHCFPKEKICIPPSSDFGKMDCRWRWKCCKKGSGK
    • Sequence Length

    • 43
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Toxin
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04703 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04703.
    • Formula

    • C346H530N90O82S8
    • Absent Amino Acids

    • TV
    • Common Amino Acids

    • K
    • Mass

    • 5017.98
    • PI

    • 9.61
    • Basic Residues

    • 15
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 20
    • Net Charge

    • +11
    • Boman Index

    • -6706
    • Hydrophobicity

    • -0.283
    • Aliphatic Index

    • 58.62
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14355
    • Absorbance 280nm

    • 224.3
    • Polar Residues

    • 19

DRAMP04703

DRAMP04703 chydropathy plot
    • Function

    • Cationic peptide that possess multiple functions. It acts as a cell-penetrating peptide (CPP), and as a potent voltage- gated potassium channel (Kv) inhibitor. It exhibits antimicrobial activities, hind limb paralysis, and severe muscle necrosis by a non-enzymatic mechanism (By similarity).
    • Tissue specificity

    • Expressed by the venom gland.
  • ·Literature 1
    • Title

    • Nucleotide sequence of crotamine isoform precursors from a single South American rattlesnake (Crotalus durissus terrificus).
    • Reference

    • Toxicon. 1999 Jul;37(7):973-984.
    • Author

    • Rádis-Baptista G, Oguiura N, Hayashi MA, Camargo ME, Grego KF, Oliveira EB, Yamane T.