General Information

    • DRAMP ID

    • DRAMP04706

    • Peptide Name

    • Myotoxin-1 (Myotoxin I)

    • Source

    • Crotalus oreganus concolor (Midget faded rattlesnake) (Crotalusviridis concolor)

    • Family

    • Belongs to the crotamine-myotoxin family

    • Gene

    • Not found

    • Sequence

    • YKRCHKKEGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVN

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Toxin

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04706 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C223H349N65O56S7

    • Absent Amino Acids

    • AQ

    • Common Amino Acids

    • K

    • Mass

    • 5061.05

    • PI

    • 9.51

    • Basic Residues

    • 13

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +10

    • Boman Index

    • -9152

    • Hydrophobicity

    • -0.872

    • Aliphatic Index

    • 31.63

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 306.31

    • Polar Residues

    • 15

DRAMP04706

DRAMP04706 chydropathy plot

Comments Information

    • Function

    • Cationic peptide that possess multiple functions. It acts as a cell-penetrating peptide (CPP), and as a potent voltage- gated potassium channel (Kv) inhibitor. It exhibits antimicrobial activities, hind limb paralysis, and severe muscle necrosis by a non-enzymatic mechanism (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

Literature Information

  • ·Literature 1

    • Title

    • Amino acid sequences of myotoxins from Crotalus viridis concolor venom.

    • Reference

    • Toxicon. 1987;25(6):677-680.

    • Author

    • Bieber AL, McParland RH, Becker RR.