General Information

    • DRAMP ID

    • DRAMP04707

    • Peptide Name

    • Myotoxin-A (Myotoxin-1)

    • Source

    • Crotalus viridis viridis (Prairie rattlesnake)

    • Family

    • Belongs to the crotamine-myotoxin family

    • Gene

    • Not found

    • Sequence

    • YKQCHKKGGHCFPKEKICIPPSSDLGKMDCRWKWKCCKKGSG

    • Sequence Length

    • 42

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Toxin

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Sarcoplasmic reticulum calcium-ATPase (Ref.3)

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04707 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04707.

Physicochemical Information

    • Formula

    • C211H334N62O54S7

    • Absent Amino Acids

    • ANTV

    • Common Amino Acids

    • K

    • Mass

    • 4827.78

    • PI

    • 9.47

    • Basic Residues

    • 13

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +10

    • Boman Index

    • -8274

    • Hydrophobicity

    • -1.041

    • Aliphatic Index

    • 27.86

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 313.78

    • Polar Residues

    • 15

DRAMP04707

DRAMP04707 chydropathy plot

Comments Information

    • Function

    • Cationic peptide that possess multiple functions. It acts as a cell-penetrating peptide (CPP), and as a potent voltage- gated potassium channel (Kv) inhibitor. It exhibits antimicrobial activities, hind limb paralysis, and severe muscle necrosis by a non-enzymatic mechanism (By similarity).(Ref.2)

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains three disulfide bonds.(Ref.1)

    • Toxic Dose

    • LD(50) is 3.0 mg/kg by intramuscular injection.

Literature Information

  • ·Literature 1

    • Title

    • Amino acid sequence and disulfide bond assignment of myotoxin a isolated from the venom of Prairie rattlesnake (Crotalus viridis viridis).

    • Reference

    • Biochemistry. 1979 Feb 20;18(4):678-684.

    • Author

    • Fox JW, Elzinga M, Tu AT.
  • ·Literature 2

    • Title

    • Multiple myotoxin sequences from the venom of a single prairie rattlesnake (Crotalus viridis viridis).

    • Reference

    • Toxicon. 1991;29(2):265-268.

    • Author

    • Aird SD, Kruggel WG, Kaiser II.
  • ·Literature 3

    • Title

    • Structure-function relationship of myotoxin a using peptide fragments.

    • Reference

    • Arch Biochem Biophys. 1992 Nov 1;298(2):325-331.

    • Author

    • Baker B, Utaisincharoen P, Tu AT.