General Information

    • DRAMP ID

    • DRAMP04710

    • Peptide Name

    • Myotoxin-2

    • Source

    • Crotalus viridis viridis (Prairie rattlesnake)

    • Family

    • Belongs to the crotamine-myotoxin family

    • Gene

    • Not found

    • Sequence

    • YKRCHKKEGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVNNA

    • Sequence Length

    • 45

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Toxin

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04710 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04710.

Physicochemical Information

    • Formula

    • C230H360N68O59S7

    • Absent Amino Acids

    • Q

    • Common Amino Acids

    • K

    • Mass

    • 5246.23

    • PI

    • 9.51

    • Basic Residues

    • 13

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +10

    • Boman Index

    • -9635

    • Hydrophobicity

    • -0.871

    • Aliphatic Index

    • 32.44

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 292.39

    • Polar Residues

    • 16

DRAMP04710

DRAMP04710 chydropathy plot

Comments Information

    • Function

    • Cationic peptide that possess multiple functions. It acts as a cell-penetrating peptide (CPP), and as a potent voltage- gated potassium channel (Kv) inhibitor. It exhibits antimicrobial activities, hind limb paralysis, and severe muscle necrosis by a non-enzymatic mechanism (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

Literature Information

  • ·Literature 1

    • Title

    • A new small myotoxin from the venom of the prairie rattlesnake (Crotalus viridis viridis).

    • Reference

    • FEBS Lett. 1990 Nov 12;274(1-2):43-47.

    • Author

    • Griffin PR, Aird SD.