General Information

    • DRAMP ID

    • DRAMP04714

    • Peptide Name

    • Crotamine-IV-2

    • Source

    • Crotalus durissus cumanensis (South American rattlesnake)

    • Family

    • Belongs to the crotamine-myotoxin family

    • Gene

    • Not found

    • Sequence

    • YKRCHIKGGHCFPKEKLICIPPSSDIGKMDCPWKRKCCKKRS

    • Sequence Length

    • 42

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Toxin

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04714 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04714.

Physicochemical Information

    • Formula

    • C214H351N65O53S7

    • Absent Amino Acids

    • ANQTV

    • Common Amino Acids

    • K

    • Mass

    • 4906.96

    • PI

    • 9.65

    • Basic Residues

    • 14

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +11

    • Boman Index

    • -9586

    • Hydrophobicity

    • -0.862

    • Aliphatic Index

    • 46.43

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 179.63

    • Polar Residues

    • 13

DRAMP04714

DRAMP04714 chydropathy plot

Comments Information

    • Function

    • Cationic peptide that possess multiple functions. It acts as a cell-penetrating peptide (CPP), and as a potent voltage- gated potassium channel (Kv) inhibitor. It exhibits antimicrobial activities, and hind limb paralysis (By similarity). It also induces potent blockade of neuromuscular transmission in young chicken biventer cervicis preparation and potent myotoxic effect. In mice, it induces myonecrosis, upon intramuscular or subcutaneous injections.

    • Tissue specificity

    • Expressed by the venom gland.

    • Toxic Dose

    • LD(50) is 0.07 mg/kg by subcutaneous injection.

Literature Information

  • ·Literature 1

    • Title

    • Structural and biological characterization of two crotamine isoformsIV-2 and IV-3 isolated from the Crotalus durissus cumanensis venom.

    • Reference

    • Protein J. 2007 Dec;26(8):533-540.

    • Author

    • Ponce-Soto LA, Martins-de-Souza D, Novello JC, Marangoni S.