General Information

    • DRAMP ID

    • DRAMP04716

    • Peptide Name

    • Myotoxin (Crotamine-4; Toxic peptide C)

    • Source

    • Crotalus oreganus helleri (Southern pacific rattlesnake) (Crotalusviridis helleri)

    • Family

    • Belongs to the crotamine-myotoxin family

    • Gene

    • Not found

    • Sequence

    • YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVNNAISI

    • Sequence Length

    • 48

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Toxin

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04716 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04716.

Physicochemical Information

    • Formula

    • C368H569N95O88S8

    • Absent Amino Acids

    • Q

    • Common Amino Acids

    • K

    • Mass

    • 5487.56

    • PI

    • 9.65

    • Basic Residues

    • 14

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 25

    • Net Charge

    • +11

    • Boman Index

    • -4962

    • Hydrophobicity

    • 0.041

    • Aliphatic Index

    • 75.29

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14355

    • Absorbance 280nm

    • 208.04

    • Polar Residues

    • 22

DRAMP04716

DRAMP04716 chydropathy plot

Comments Information

    • Function

    • Cationic peptide that possess multiple functions. It acts as a cell-penetrating peptide (CPP), and as a potent voltage- gated potassium channel (Kv) inhibitor. It exhibits antimicrobial activities, hind limb paralysis, and severe muscle necrosis by a non-enzymatic mechanism (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

    • Toxic Dose

    • LD(50) is 1.96 mg/kg by subcutaneous injection.

Literature Information

  • ·Literature 1

    • Title

    • Some chemical properties of the venom of the rattlesnake, Crotalus viridis helleri.

    • Reference

    • Toxicon. 1978;16(5):431-441.

    • Author

    • Maeda N, Tamiya N, Pattabhiraman TR, Russell FE.