General Information

    • DRAMP ID

    • DRAMP04718

    • Peptide Name

    • Crotamine Ile-19 (CRO_Ile-19)

    • Source

    • Crotalus durissus ruruima (South American rattlesnake) (Mt. Roraimarattlesnake)

    • Family

    • Belongs to the crotamine-myotoxin family

    • Gene

    • Not found

    • Sequence

    • YKQCHKKGGHCFPKEKICIPPSSDFGKMDCRWRWKCCKKGSG

    • Sequence Length

    • 42

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Toxin

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • The crystal structure of the myotoxic, cell-penetrating, basic polypeptide crotamine isolated from the venom of Crotalus durissus terrificus has been determined by single-wavelength anomalous dispersion techniques and refined at 1.7 Å resolution. The structure reveals distinct cationic and hydrophobic surface regions that are located on opposite sides of the molecule. (Ref.2)

    • Helical Wheel Diagram

    • DRAMP04718 helical wheel diagram

    • PDB ID

    • 4GV5 resolved by X-ray

    • Predicted Structure

    • There is no predicted structure for DRAMP04718.

Physicochemical Information

    • Formula

    • C214H332N64O54S7

    • Absent Amino Acids

    • ALNTV

    • Common Amino Acids

    • K

    • Mass

    • 4889.81

    • PI

    • 9.51

    • Basic Residues

    • 13

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +10

    • Boman Index

    • -9405

    • Hydrophobicity

    • -1.079

    • Aliphatic Index

    • 18.57

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 313.78

    • Polar Residues

    • 15

DRAMP04718

DRAMP04718 chydropathy plot

Comments Information

    • Function

    • Cationic peptide that possess multiple functions. It acts as a cell-penetrating peptide (CPP), and as a potent voltage- gated potassium channel (Kv) inhibitor and exhibits antimicrobial activities (By similarity). It also elicts a short-lasting hyperextension of the hind limb. It does not causes observable tissue damage (whereas the whole venom causes severe myonecrosis accompanied by edema and hemorrhage).

Literature Information

  • ·Literature 1

    • Title

    • Purification and properties of a crotamine analog from Crotalus durissus ruruima venom.

    • Reference

    • Toxicon 1993,31:166-166.

    • Author

    • Dos Santos M.C., Morhy L., Ferreira L.C.L., Oliveira E.B.
  • ·Literature 2

    • Title

    • Structure of the polypeptide crotamine from the Brazilian rattlesnake Crotalus durissus terrificus.

    • Reference

    • Acta Crystallogr D Biol Crystallogr. 2013 Oct;69(Pt 10):1958-1964.

    • Author

    • Coronado MA, Gabdulkhakov A, Georgieva D, Sankaran B, Murakami MT, Arni RK, Betzel C.