• DRAMP ID

    • DRAMP18097
    • Peptide Name

    • Kunitz-type serine protease inhibitor U1-aranetoxin-Av1a (U1-AATX-Av1a; Toxin 1; AvTox-1)
    • Source

    • Araneus ventricosus (Orbweaver spider) (Epeira ventricosa)
    • Family

    • Belongs to the venom Kunitz-type family
    • Gene

    • Not found
    • Sequence

    • MPFHYFPKLNPITWIPGWIPGLGKDRCLLPKVTGPCKASLTRYYYDKDTKACVEFIYGGCRGNRNNFKRKDECEKACTDH
    • Sequence Length

    • 80
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Insecticidal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18097 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18097.
    • Formula

    • C418H636N114O112S7
    • Absent Amino Acids

    • Q
    • Common Amino Acids

    • K
    • Mass

    • 9274.76
    • PI

    • 9.11
    • Basic Residues

    • 16
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 20
    • Net Charge

    • +8
    • Boman Index

    • -10000
    • Hydrophobicity

    • -0.671
    • Aliphatic Index

    • 54.88
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 18825
    • Absorbance 280nm

    • 238.29
    • Polar Residues

    • 28

DRAMP18097

DRAMP18097 chydropathy plot
    • Function

    • Putative insecticidal toxin that may inhibit trypsin.##Miscellaneous
  • ·Literature 1
    • Title

    • Molecular cloning of two cDNAs encoding an insecticidal toxin fromthe spider, Araneus ventricosus, and construction of a recombinantbaculovirus expressing a spider toxin.
    • Reference

    • Int. J. Ind. Entomol. 4:43-49 (2002)
    • Author

    • Jung E.H., Lee K.S. , Han J.H., Je Y.H., Chang J.H., Roh J.Y., Sohn H.D., Jin B.R.