• DRAMP ID

    • DRAMP18098
    • Peptide Name

    • U2-aranetoxin-Av1a (U2-AATX-Av1a; Toxin 2; AvTox-2)
    • Source

    • Araneus ventricosus (Orbweaver spider) (Epeira ventricosa)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MALALLGLTIKPEHVPEGTGKAVADVEALACDPAQCMRSCPFNPFLNQYGGICKNGQCVCVKPS
    • Sequence Length

    • 64
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Insecticidal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18098 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18098.
    • Formula

    • C291H469N79O86S8
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • ACGLP
    • Mass

    • 6706.88
    • PI

    • 6.51
    • Basic Residues

    • 6
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 22
    • Net Charge

    • +1
    • Boman Index

    • -3206
    • Hydrophobicity

    • 0.183
    • Aliphatic Index

    • 82.34
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 29.6
    • Polar Residues

    • 20

DRAMP18098

DRAMP18098 chydropathy plot
    • Function

    • Putative insecticidal toxin.##Miscellaneous
  • ·Literature 1
    • Title

    • Molecular cloning of two cDNAs encoding an insecticidal toxin fromthe spider, Araneus ventricosus, and construction of a recombinantbaculovirus expressing a spider toxin.
    • Reference

    • Int. J. Ind. Entomol. 4:43-49 (2002).
    • Author

    • Jung E.H., Lee K.S. , Han J.H., Je Y.H., Chang J.H., Roh J.Y., Sohn H.D., Jin B.R.