General Information

    • DRAMP ID

    • DRAMP18102

    • Peptide Name

    • Beta/delta-agatoxin-2 (Mu-2Aga_08; U3-agatoxin-Ao1g; U3-AGTX-Ao1g)

    • Source

    • Agelena orientalis (Spider)

    • Family

    • Belongs to the beta/delta-agatoxin family

    • Gene

    • Not found

    • Sequence

    • GGCVGESQQCADWSGPYCCKGYYCTCRYFPKCICVNDN

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18102 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18102.

Physicochemical Information

    • Formula

    • C356H556N92O106S10

    • Absent Amino Acids

    • H

    • Common Amino Acids

    • GC

    • Mass

    • 4222.77

    • PI

    • 6.07

    • Basic Residues

    • 7

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 23

    • Net Charge

    • -1

    • Boman Index

    • -5878

    • Hydrophobicity

    • 0.211

    • Aliphatic Index

    • 80.27

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11960

    • Absorbance 280nm

    • 163.84

    • Polar Residues

    • 30

DRAMP18102

DRAMP18102 chydropathy plot

Comments Information

    • Function

    • Insecticidal neurotoxin that modulates the insect Nav channel (DmNaV1/tipE (para/tipE)) in a unique manner, with both the activation and inactivation processes being affected. The voltage dependence of activation is shifted toward more hyperpolarized potentials (analogous to site 4 toxins) and a non- inactivating persistent sodium current is induced (site 3-like action). Interestingly, both effects take place in a voltage- dependent manner, producing a bell-shaped curve between -80 and 0 mV. Compared to beta/delta-agatoxin-1 to -3, this toxin appears to affect the insect sodium channel only weakly.##Miscellaneous

Literature Information

  • ·Literature 1

    • Title

    • A novel strategy for the identification of toxinlike structures inspider venoM.

    • Reference

    • Proteins 59:131-140 (2005).

    • Author

    • Kozlov S. A., Malyavka A., McCutchen B., Lu A., Schepers E., Herrmann R., Grishin E.V.
  • ·Literature 2

    • Title

    • Unique bell-shaped voltage-dependent modulation of Na+ channel gatingby novel insect-selective toxins from the spider Agelena orientaliS.

    • Reference

    • J. Biol. CheM. 285:18545-18554 (2010).

    • Author

    • Billen B., Vassilevski A., Nikolsky A., Debaveye S. , Tytgat J., Grishin E.